Beskrivning

Produktbeskrivning:

750W 4L destillerat vattenmaskin - lev ditt livskvalitet,

Skydda din hälsa med denna dispenser för destillerat vatten som hjälper dig att få en konstant tillförsel av destillerat vatten hemma eller på kontoret.

Destillationsapparaten kan effektivt lösa upp VOC och filtrera andra föroreningar, och destillationshastigheten kan nå 1,3 liter vatten per timme. Ännu viktigare är att den inre tanken är gjord av högkvalitativt 304 rostfritt stål, som har funktionen att förhindra torrbränning. Den perfekta hjälpen för ditt kök.

Produkten har erhållit ISO 9001:2015 kvalitetsledningssystemcertifikat, CE-märkning och har registrerats hos US FDA.

-Effektiv vattenrening

-Lätt att använda och underhålla

- Snabb värmeavledning

- Användarvänliga detaljer

- Hälsa och säkerhet

Huvuddrag:

-Kraftfull destillationsprestanda.

Med hastigheter på över 0,34 gallon/1,3 liter per timme, tar 750W destillerat vattenmaskinen bort de flesta föroreningar från kranvatten såsom VOC, lösta fasta ämnen och nästan alla andra föroreningar. Den kan destillera totalt 8,24 gal/31,2 L per dag, för att inte påverka din smak rekommenderar vi att du byter filterpatron en gång i veckan.

- hygieniska material av hög kvalitet,

100 % livsmedelsklassat material: 304 rostfritt stål innertank, innerlock, utlopp och inlopp; BPA-fri plastbehållare med ergonomiskt handtag och aluminiumfläktblad; flexibel ledning för att förhindra läckage. Hållbar och kompakt nog att passa var som helst.

- Enkel brytarkontroll,

Enknappsstart, återställningsknappen används under destillationsprocessen, vilket är bekvämt och behöver inte kopplas in och ur. Den har också en automatisk övertemperaturskyddsfunktion. När temperaturen är högre än 239?/115? kommer den automatiskt att stänga av strömförsörjningen, vilket gör att du kan använda den med sinnesfrid.

- Effektivt kylsystem,

Den fyrbladiga fläkten på den övre kåpan på destillationsapparaten är gjord av aluminium istället för ömtålig plast, och avgaskåpan är också bytt från plast till 304 rostfritt stål. För att säkerställa god värmeavledning och lång livslängd.

- Genomtänkt design,

Den lätta att bära destillatören inkluderar en hållbar uppsamlingsflaska, gratis kolpaket och AHA-rengöringsmedel som behövs för att rena vatten och säkerställa det renaste och säkraste destillerade vattnet för alla dina behov. Och botten har anti-halkfötter, inte lätt att falla.

- flera applikationer,

Distiller kan ta bort de flesta föroreningar från kranvatten och är idealisk för kontor, hem, laboratorier, sjukhus, tandläkarmottagningar. Destillerat vatten kan användas som dagligt dricksvatten, kaffebryggningsvatten, skönhetssalongsvattenrening etc.

Specifikation:

Effekt: 750 watt

Destillationshastighet: 0,34 Gal/H (1,3 L/H)

Behållarvolym: 1,1 gallons/4 liter

Pipdiameter: 7,7"/195mm

Fatmaterial: 304 rostfritt stål

Behållarens mått: Diameter - 7,2 x 7,1 tum / 183 x 180 mm

Produktmått: Diameter - 9,1 x 15,2 tum / 232 x 385 mm

Paket innehåll:

1 x Distiller

1 glas vattenbehållare

3 x kolförpackningar

1 x flaska fruktrengöringspulver

1 x Användarmanual

Funktioner och detaljer:

Högeffektiv vattenrening: Effekt: 750W; Volym: 4L/1,1 gallon. Detta vatten kan fortfarande destillera 6 gal/22,7 L per dag för att avlägsna lösta fasta partiklar, VOC och praktiskt taget alla andra föroreningar, vilket ger dig det renaste vattnet som möjligt. Perfekt för destillerat vatten, alkohol etc. Perfekt för kontor, hem, laboratorier, tandläkarmottagningar och mer.

Hälsa och säkerhet: Allt 304 rostfritt stål, inklusive innertank, innerlock, vattenutlopp, vatteninlopp och alla delar i kontakt med vätska, uppfyller livsmedelshygieniska standarder. De har CE- och FDA-certifikat, BPA-fria plastbehållare och kylfläktar i aluminium.

LÄTT ATT ANVÄNDA OCH UNDERHÅLL: Maskinen för destillerat vatten kan startas med en knapptryckning, och det finns även en automatisk avstängningsknapp inuti. När uppvärmningstemperaturen överstiger 239°F/115°C, stängs destillatören automatiskt av för att undvika skador på maskinen på grund av för hög temperatur.

Snabb värmeavledning: Till skillnad från fläktblad i plast, byts våra bänkskivor till fläktblad i aluminium för att förbättra värmeavledningen. Avgaslocket ändras även från plast till 304 rostfritt stål, vilket förbättrar värmeavledningsförmågan.

Humaniserade detaljer: Den uppgraderade hemmaskinen för destillerat vatten har ett unikt bärbart handtag på toppen, som är bekvämt att bära. Vattenbehållaren har stor öppning och ergonomiskt handtag för enkel åtkomst och rengöring. Vi tillhandahåller även kolförpackningar och rengöringsmedel för fruktsyra gratis, inga ytterligare köp krävs.

Objektnr 639 040 356

Visningar 25

Publicerad

AnmälSälj liknande

Mer från säljaren

Andra har även tittat på

Jämför slutpriser

Vad är den värd?

Andra gillar också

Sön 18 aug 19:01

750W 4L hushållsmaskin för destillerat vatten,rent vattenfilter i rostfritt stål

Pris

1 759 kr

funstation4u

Sundbyberg, Sverige

4.9

funstation4u

Verifierad

Toppsäljare

330 omdömen

Läs omdömen